Who are christiandachshundpuppies.com?
Christiandachshundpuppies.com use the email christiandachshundpuppies1@gmail.com.
When you’re in the market for a new puppy be wary of dealing with Christiandachshundpuppies.com. The internet is a great place to
start your search, with many Dachshund breeders and pet sellers advertising online. However, you have to be wary of deals that seem too good to be true. If a puppy is being sold for significantly less than market value, it could be a red flag that the puppy is coming from a scammer. Be sure to do your research on Dachshunds. Make sure you understand the breed’s characteristics, needs, and any potential health issues and more importantly, the average price for a Dachshund puppy. This will help you find the right puppy for you and your family.In summary, while the internet can be a great place to find a new Dachshund, it’s important to be vigilant and do your research to ensure that you’re not getting scammed by websites like Christiandachshundpuppies.com. By being mindful of these issues, you can increase your chances of finding the perfect puppy for you and your family.
Can I trust christiandachshundpuppies.com reviews?
It is important to be cautious when reading online reviews, as they will not always be genuine. Scammers create fake reviews on CHRISTIAN DACHSHUND HOME – Licensed Dachshund Breeder as well as on other review sites, such as Facebook, TrustPilot or Google reviews. Fake reviews may be written in a similar style or contain similar language and often copied entirely word for word. You can check for multiple reviews with the same text on different websites. It’s a good idea to read reviews from multiple sources and pay attention to negative reviews.

Is Christiandachshundpuppies.com legit?
How long has Christiandachshundpuppies.com existed?
Christiandachshundpuppies.com may look like a legitimate breeder however there are many red flags to watch out for.
If you check the WHOIS for Christiandachshundpuppies.com you will see that it was registered on 25 of April 2024 which is only 2 weeks ago.
The domain is only registered for 1 year and expires in April 2025 which is in 1 year.
Recheck the website. Does this match with what they say about their company? Do they claim to be be established for much longer than the website has been running?
Where are Christiandachshundpuppies.com located?
It is very difficult to accurately find the location for Christiandachshundpuppies.com. Scammers will often ask you for your location and then claim to be at the opposite side of the country. This allows them to scam you out of even more money by charging you for pet transportation services.
One thing they that is certain is that the information they give you will be false.
Their domain was registered with the following information:
Email address: contact@privacyprotect.org
Name Used: Domain Admin
Physical address: 10 Corporate Drive
City: Burlington
Zip: 01803
Country: United States
Most times the address on the WHOIS is not the location of the scammer. Very often they will use a privacy service to hide their details.
Site Text
christiandachshundpuppies1.com menu contact us >contact us christiandachshundpuppies1@gmail.com puppy name * blueskyedpeppermarthapascalwinnieamoalilysparkleluna your names * your email * your phone number * your city * your state * your message * © copyright – 2024 christian dachshund home llc all rights reserved
Christiandachshundpuppies.com content
What to do next?
Our goal is to gather as much information as possible about Christiandachshundpuppies.com and the individuals behind it. By providing us with details about the criminals, we can create a comprehensive understanding of the scammer’s network and take steps to shut it down.
We welcome any information about the scammers, even if you haven’t lost any money. Disrupting their payment methods can have a greater impact on their operations than just shutting down a website, which can easily be recreated.
Protip: If the scammers provide you with bank account information, request that they use Bitcoin instead. If they offer a Zelle account, ask for a bank account to transfer the funds to. You can report multiple accounts to us for further investigation.
You should never give your banking information to these scammers
If you live in the US it is important to report this scam to the BBB. Click here to see why. As well as the Better Business Bureau you should report this crime to the Federal Trade Commission. See Here