Who are christiandachshundpups.com?

Christiandachshundpups.com use the email [email protected].

When you’re in the market for a new puppy be wary of dealing with Christiandachshundpups.com. The internet is a great place to start your search, with many Dachshund breeders and pet sellers advertising online. However, you have to be wary of deals that seem too good to be true. If a puppy is being sold for significantly less than market value, it could be a red flag that the puppy is coming from a scammer. Be sure to do your research on Dachshunds. Make sure you understand the breed’s characteristics, needs, and any potential health issues and more importantly, the average price for a Dachshund puppy. This will help you find the right puppy for you and your family.

In summary, while the internet can be a great place to find a new Dachshund, it’s important to be vigilant and do your research to ensure that you’re not getting scammed by websites like Christiandachshundpups.com. By being mindful of these issues, you can increase your chances of finding the perfect puppy for you and your family.

Can I trust christiandachshundpups.com reviews?

When it comes to online reviews, it’s important to be skeptical and do your own research. As a general rule of thumb, I always try to read reviews from multiple sources and look for copied reviews which indicates that a review is fake. Additionally, I research the author of a review for Christiandachshundpups.com to see if their other reviews are for similar scammy websites. It’s always better to be safe than sorry and by doing a little bit of digging you can ensure that you’re making an informed decision.

is CHRISTIAN DACHSHUND HOME – Licensed Dachshund Breeder legit? screenshot
Screenshot of christiandachshundpups.com

Is Christiandachshundpups.com legit?

How long has Christiandachshundpups.com existed?

Christiandachshundpups.com may look like a legitimate breeder however there are many red flags to watch out for.

If you check the WHOIS for Christiandachshundpups.com you will see that it was registered on 16 of August 2024 which is only 4 weeks ago.
The domain is only registered for 1 year and expires in August 2025 which is in 11 months.
Recheck the website. Does this match with what they say about their company? Do they claim to be be established for much longer than the website has been running?

Where are Christiandachshundpups.com located?

It can be difficult to accurately determine the location of Christiandachshundpups.com. Scammers may claim to be located in one location, but in reality, they may be located in a different location entirely. This can be used to scam individuals out of money, such as by charging for pet transportation services.
To protect yourself, it is important to verify the location of a domain through reliable sources before conducting any transactions.

Their domain was registered with the following information:
Email address: Not Known
Name Used: Not Known
Physical address: Not Known
City: Not Known
Zip: Not Known
Country: Not Known

Most times the address on the WHOIS is not the location of the scammer. Very often they will use a privacy service to hide their details.

Site Text

christiandachshundpuppies1.com menu contact us >contact us [email protected] puppy name * blueskyedpeppermarthapascalwinnieamoalilysparkleluna your names * your email * your phone number * your city * your state * your message * © copyright – 2024 christian dachshund home llc all rights reserved

Christiandachshundpups.com content

What to do next?

Our goal is to gather as much information as possible about Christiandachshundpups.com and the individuals behind it. By providing us with details about the criminals, we can create a comprehensive understanding of the scammer’s network and take steps to shut it down.

We welcome any information about the scammers, even if you haven’t lost any money. Disrupting their payment methods can have a greater impact on their operations than just shutting down a website, which can easily be recreated.

Protip:  If the scammers provide you with bank account information, request that they use Bitcoin instead. If they offer a Zelle account, ask for a bank account to transfer the funds to. You can report multiple accounts to us for further investigation.

You should never give your banking information to these scammers

If you live in the US it is important to report this scam to the BBB. Click here to see why. As well as the Better Business Bureau you should report this crime to the Federal Trade Commission. See Here

Categorized in:

Tagged in: